PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010128-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 128aa    MW: 14552.7 Da    PI: 9.6239
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010128-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.35e-3142100159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +dDg++WrKYG+K+vk+s++pr+YYrC+s gC+vkk+ver++ed ++v++tYeg Hnhe
  NNU_010128-RA  42 MDDGFKWRKYGKKTVKNSPNPRNYYRCSSGGCNVKKRVERDREDSSYVITTYEGVHNHE 100
                    69********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-3330102IPR003657WRKY domain
SuperFamilySSF1182902.09E-2834102IPR003657WRKY domain
PROSITE profilePS5081131.36437102IPR003657WRKY domain
SMARTSM007748.0E-3542101IPR003657WRKY domain
PfamPF031069.1E-2543100IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MIFTLLVVCS CGCRKCKGGL KKIKTDAGFR IAFRTKSELE IMDDGFKWRK YGKKTVKNSP  60
NPRNYYRCSS GGCNVKKRVE RDREDSSYVI TTYEGVHNHE SPCVVYYNEM PLMVPSGWTL  120
QASNSSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-2630102274WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261070.17e-81PREDICTED: probable WRKY transcription factor 51
SwissprotQ93WU91e-43WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLF6H4B46e-65F6H4B4_VITVI; Putative uncharacterized protein
STRINGVIT_07s0031g01710.t012e-64(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.15e-45WRKY DNA-binding protein 51